PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc06696.1.g00030.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family MYB
Protein Properties Length: 694aa    MW: 77133.9 Da    PI: 10.5929
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc06696.1.g00030.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding60.73.1e-19437484148
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                                   +g+WT++Edell+d+v+q+G g+W+++++  g++R++k+c++rw +yl
  Zmw_sc06696.1.g00030.1.am.mk 437 KGPWTAQEDELLLDYVRQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 484
                                   79********************************************97 PP

2Myb_DNA-binding49.31.2e-15490534147
                                   TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
               Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                   rg+ T++E+  ++++++++G++ W+tIar ++ gRt++++k++w+++
  Zmw_sc06696.1.g00030.1.am.mk 490 RGKITPQEESVILELHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 534
                                   8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.538432484IPR017930Myb domain
SuperFamilySSF466891.2E-29435531IPR009057Homeodomain-like
SMARTSM007177.2E-17436486IPR001005SANT/Myb domain
PfamPF002491.2E-17437484IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.8E-23438491IPR009057Homeodomain-like
CDDcd001678.11E-13439484No hitNo description
PROSITE profilePS5129424.933485539IPR017930Myb domain
SMARTSM007174.5E-15489537IPR001005SANT/Myb domain
PfamPF002492.1E-13490534IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.4E-23492537IPR009057Homeodomain-like
CDDcd001672.53E-10494535No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 694 aa     Download sequence    Send to blast
MTTNSPARAT HGVVLLLTIR VSFRPTSRDH ERLCSGVCLE RAALVGGLPD SSLFALFPSV  60
SIDPSRSEDV IASYPSITAP TPVPVYNSRA HALALVSLCC WGRGRHKPSN QRPVGPRRTR  120
AHWWWRRGSD RSTFRCGTRP RGGVRGAWCV VVGLGARHRS RVDDEAVPGP DDGGQGRATE  180
GSTRGPDVAR AERPGDGDVA RSKARSNNGG FTHRGGGGRP GRFLPMATAA ATQTSREQRF  240
FRCEPRRLGF FRFLLTLEAT GRGKAAARCS ASHAQVGTKP ESTISADALD KRKRTKGPRQ  300
TQVYCAGAEA LSPRQGAPEL GPRLVLELAD MVCPCRGSST QHQEAQVLRY SRRGRAFGRN  360
PTWQWGAPDS DFGLRRACAP IYIFTSPRRL ARSLRRRAAT VQVRKVDRLA RSLRGEGEVG  420
MMDGQFGWGR GEGGWRKGPW TAQEDELLLD YVRQHGEGRW NSVSKLTGLK RSGKSCRLRW  480
VNYLRPDLKR GKITPQEESV ILELHALWGN RWSTIARSLP GRTDNEIKNY WRTHFKKGKP  540
SKNIERARAR FLKQRREMQS QMLIQGQEQQ QQQMQQLKQP GDHDHAVTRQ QAAPAVSSPA  600
PQHEDLQMML LDMDDLLYQL CPMSMSSCSS SYYHFHGGSV SASAASEGSS EDQLDGGDTW  660
GWGSLWNLDD MVDDIDGGWD SSCPWLQEQG LAFY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A4e-254375377106B-MYB
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584